Ақпарат

Ақуыздың 3D құрылымын анықтау қаншалықты қиын?

Ақуыздың 3D құрылымын анықтау қаншалықты қиын?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Мен интернетте ондаған мың PDB файлдарын көріп тұрмын. Мен өзімді қызықтыратын ақуыздың 3D құрылымын анықтағым келеді. Мен 3D құрылымын анықтау күрделі, қымбат және мамандандырылған процедура екенін естідім, ол айлар немесе жылдарға созылуы мүмкін және оны жүйелі түрде орындау немесе тіпті коммерциялық жолмен сатып алу қиын.

Неліктен және қаншалықты қиын екенін түсіндіре аласыз ба? Мұндай экспериментті орындау үшін әдетте қандай талаптар және қанша бюджет қажет?


Протеин құрылымын эксперименталды түрде анықтау қиын: ең көп тараған әдіс - рентгендік кристаллография, егер сәттілік болса, бірнеше айда жасауға болады, ал болмаса, жылдарға созылуы мүмкін. Рентгендік кристаллографияның проблемасы сізге жақсы ақуыз кристалдары қажет және көп жағдайда белоктар өте жақсы кристалданбайды, сондықтан дұрыс кристалды алу үшін көп уақыт (және көп тазартылған ақуыз) қажет. (Түсініктемелер бөлімінде Коди АТФ синтазасына қатысты құрылымды анықтау үшін рентгендік кристаллографиямен тереңірек байланысқан кейбір жақсы сілтемелерді қосты).

Құны негізінен сізге қажет материалдар мен жұмыс күшіне негізделген және сіз сынақтан өтуіңіз керек көп Ақуызды кристалдануға арналған әртүрлі шешімдер, олар өте арзан емес. Егер сізде кристалдарды жасауға (негізінен тамшуыр роботтары) немесе өлшеуге (рентген сәулесінің сызығы) арналған арнайы жабдыққа қол жеткізе алмасаңыз, бұл өте қымбат болады.

Кристаллография ақуыз кристалдарын қажет етеді, оларды алу кейде өте қиын. Кристалдарды қажет етпейтін басқа әдістер, мысалы, NMR және cryoEM, сәттілікке тәуелді болмаса да, орындау қиынырақ. Бұл әдістер өте қымбат жабдыққа сүйенеді және көбінесе құрылымды ақуыз кристаллографиясы сияқты дәл шеше алмайды. Сондықтан осы әдістермен тәжірибесі бар санаулы адамдардың бірін таба алмасаңыз, көптеген қосымша мәселелерге тап боласыз.

Сондай-ақ, тек қуатты компьютерді қажет ететін есептеу құрылымын болжау бар. Дегенмен, сіздің ақуызыңыз белгілі құрылымы бар ақуызға өте ұқсас болмаса, ол сенімді жұмыс істемеуі мүмкін. Түсініктемелерде айтылғандай, белгіленген әдістерге арналған веб-серверлер бар және прогресс үнемі жаңа (er) алгоритмдерде жасалады, сондықтан сіздің қажеттіліктеріңізге байланысты есептеу құрылымын болжауға тырысу керек.


Мен құрылымды анықтау үшін NMR-ге жүгінемін. Бұл азырақ таралған әдіс, ақуыз құрылымдарының тек ~10% осылай анықталады, бірақ ол, мысалы: нуклеин қышқылдары үшін артықшылықтар және олардың үштен бірінен астамы ЯМР арқылы шешілді. Мұнда кез келген сандарды өте өрескел бағалау ретінде қабылдаңыз, қиындықтар мен шығындарға әсер ететін көптеген факторлар бар.

ЯМР үшін жалғыз ең маңызды фактор - өлшем. 10-20 кД тұрақты, жақсы жұмыс істейтін ақуыз әдеттегідей. Үлкен ақуыздарды өлшеу өте қиын немесе ЯМР арқылы мүлдем мүмкін емес.

Рентген және ЯМР үшін сізге көп мөлшерде ақуыз қажет, бірақ ЯМР жағдайында ол изотоппен таңбаланған да қажет. Ақуыздарды біркелкі таңбалау 15N/13C соншалықты қымбат емес. E. coli минималды ортада (бір литр орта үшін шамамен $100 немесе одан да көп, негізінен 13С глюкозада), бірақ толық орта немесе сәнді нәрсе қажет болса, ол өте тез қымбаттауы мүмкін.

Сіздің ақуызыңыз ерітіндіде кем дегенде бірнеше күн тұрақты болуы керек, бір 3D экспериментін өлшеуге бірнеше күн қажет болуы мүмкін. Егер сіздің ақуызыңыз жеткілікті түрде тұрақты болмаса, сіз де әлдеқайда көп ақуыз өндіруге тура келеді, өйткені барлық қажетті эксперименттерді орындау үшін көптеген үлгілерді пайдалану керек. Мұндағы қиындық ЯМР эксперименттерінің сезімталдығын күрт төмендетпей, ЯМР үлгісіне көп тұз қосуға болмайды. Бірақ кейбір ақуыздардың тұзы аз ортада тұрақты болуы қиын.

Сізге жоғары өрісті ЯМР спектрометрінде бірнеше апталық өлшеу уақыты қажет, бірақ бұл көп нәрсе ақуыздың өлшеміне және үлгідегі концентрацияға және ақуыз резонанстарын тағайындаудың жалпы қиындығына байланысты. Мұндай спектрометрдің құны бірнеше миллионға жетуі мүмкін және олардың жұмыс істеуі үшін сұйық азот пен сұйық гелийді жеткізу керек. Тәулігіне $1000 өлшеу уақыты сияқты нәрсе - бұл мен құны туралы естіген сан, бірақ бұған әсер ететін көптеген факторлар бар және бұл санның қаншалықты дәл екенін айта алмаймын.

Содан кейін сіз өзіңіздің ақуызыңыздағы резонанстарды тағайындауыңыз керек, бұл бір адамға бірнеше ай қажет. Бұл қайтадан қиындыққа байланысты көп өзгереді.

Содан кейін құрылымды есептеу керек және әдетте бұл тапсырма мен талдауды нақтылаудың және есептеулерді қайта жасаудың бірнеше айналымын талап етеді. Бұл компьютердің қуаты тұрғысынан өте қымбат емес, бірақ есептеулерді жүргізетін және оларды тексеретін адамның біраз жұмысын қажет етеді.


G4. Мембраналық ақуыздың құрылымын болжау

  • Генри Якубовскийдің авторы
  • Әулие Бенедикт колледжінің (химия) профессоры. Джон университеті

Осы уақытқа дейін біз суда еритін негізінен глобулярлы белоктарды талқыладық. Белоктар мембраналармен байланысты да кездеседі. Табиғатта мембраналық ақуыздардың екі негізгі класы кездеседі.

  • перифериялық мембраналық ақуыздар: фосфолипидтердің зарядталған полярлы бас топтары мен ақуыз арасындағы электростатикалық тартылыс арқылы мембранамен қайтымды және ковалентті емес байланысқан суда еритін ақуыздар. Бұл ақуыздар көбінесе жоғары тұзды қосу арқылы мембранадан босатылуы мүмкін, өйткені олар көбінесе ақуыз бетіндегі зарядталған фосфолипидтердің бас топтары мен полярлы/зарядталған топтар арасындағы электростатикалық әрекеттесу арқылы қос қабатқа тартылады.
  • интегралды мембраналық ақуыздар: шын мәнінде қос қабатқа енеді. Оларды мембранадан шығаруға және интегралды мембрана ақуызымен аралас мицеллаларды құрайтын бір тізбекті амфифилдерді (жуғыш заттар) қосу арқылы тиімді ерітуге болады. Мембраналық ақуыздарды тазарту үшін иондық емес жуғыш заттар (Trition X-100, октилглюкозид және т.б.) жиі қолданылады. Ионды жуғыш заттар (мысалы, SDS) интегралды мембрана ақуыздарын ерітіп қана қоймайды, сонымен қатар оларды денатурациялайды.

Сурет: Мембраналық ақуыздардың түрлері

Осы интегралды мембраналық ақуыздардың кейбірінде жасушаішілік аймақтармен байланысқан ақуыздың жасушадан тыс және жасушаішілік үлкен домендері бар. Интрамембраналық аймақ көбінесе бір альфа спиральдан немесе мембрана арқылы өтетін 7 түрлі спиральді аймақтардан тұрады. Бұл трансмембраналық тізбектерді гидропатия есептеулері арқылы оңай анықтауға болады. Мысалы, интегралды мембраналық ірі қара протеин родопсинді қарастырайық. Оның 348 амин қышқылының реттілігі (бір әріптік кодта) төменде көрсетілген:

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Родопсин гидропатиясының сюжетті есептеулері оның мембрана арқылы серпентиндік жолмен өтетін жеті трансмембраналық спиралдан тұратынын көрсетеді.

Сурет: Родопсин гидропатиясының сызбасы

Сурет: жеті трансмембраналық спираль

Родопсин гидропатиясының нәтижелері

Жоқ. N терминалы трансмембраналық аймақ C терминалы түрі ұзындығы
1 40 LAAYMFLLIMLGFPINFLTLYVT 62 БАСТАУЫШ 23
2 71 PLNYILLNLAVADLFMVFGGFTT 93 ЕКІНШІ 23
3 113 EGFFATLGGEIALWSLVVLAIER 135 ЕКІНШІ 23
4 156 GVAFTWVMALACAAPPLVGWSRY 178 ЕКІНШІ 23
5 207 MFVVHFIIPLIVIFFCYGQLVFT 229 БАСТАУЫШ 23
6 261 FLICWLPYAGVAFYIFTHQGSDF 283 БАСТАУЫШ 23
7 300 VYNPVIYIMMNKQFRNCMVTTLC 322 ЕКІНШІ 23

Қорытындылай келе, гидропатия сызбалары суда еритін ақуыздардағы көмілген аймақтарды, интегралды мембраналық ақуыздардағы трансмембраналық спиральдарды, сондай-ақ иммундық жүйенің антиденелерімен танылатын беткі ілмектер құра алатын полярлы/зарядталған аминқышқылдарының қысқа бөліктерін табу үшін пайдалы. Гидропатия учаскелерінде қолданылатын терезе өлшемі есептелген нәтижелерге әсер ететіні анық. 20 аминқышқылдарының терезелері трансмембраналық спиральдарды анықтау үшін пайдалы, ал 5-7 аминқышқылдарының терезелері беткі гидрофильді жерлерді табу үшін қолданылады.

Мембраналық ақуыздар бір тізбекті амфифилдерді (жуғыш заттар) қосу арқылы ерітіледі. Жуғыш заттардың полярлы емес құйрықтары мембраналық ақуыздың гидрофобты трансмембраналық доменімен өзара әрекеттесіп, "аралас" мицелла тәрізді құрылымды құрайды. Triton X-100 және октил-глюкозид сияқты иондық емес жуғыш заттар мембраналық ақуыздарды жақын жерде еріту үшін жиі қолданылады. Керісінше, натрий дедецил сульфаты (теріс зарядталған бас тобы бар) сияқты иондық жуғыш заттар еріту процесі кезінде ақуыздарды денатурациялайды. Мембраналық ақуыздарды анағұрлым табиғи ортада зерттеу үшін иондық емес жуғыш затпен ерітілген ақуыздарды сіз бояғыш капсулаланған үлкен бірқабатты көпіршіктерді (LUVs) дайындаған 1-зертханадағы әдістерге ұқсас әдістерді пайдалана отырып, екі қабатты липосома құрылымдарына қайта құруға болады. Дегенмен, липосомалардағы мембраналық ақуыздардың жасушаішілік және жасушадан тыс домендерін зерттеу қиын болуы мүмкін, өйткені сол домендердің біреуі липосоманың ішінде жасырылған. Бұл тосқауылды алып тастайтын жаңа әдісті жақында Слигар әзірледі. Ол ортасында тесігі бар амфифилді ақуыз дискісін жасады. Ішкі саңылау полярлы емес қалдықтармен қапталған, ал дискінің сыртқы беті полярлы. Дискілерді фосфлипидтерге қосқанда, дискінің ішінде шағын қос қабаттар пайда болды. b-2 адренергиялық рецептор сияқты мембраналық ақуыздар рецепторлық ақуыздың жасушаішілік және жасушадан тыс домендерінің еріткіш әсеріне мүмкіндік беретін нанодискінің қос қабаттарында қалпына келтірілуі мүмкін.


Дебора Маркс

Жүйелік биология кафедрасының доценті
Marks Lab веб-сайты

Байланыс ақпараты
Электрондық пошта: [email protected]

Факультет ассистенті: Кевин Чимо
[email protected]
617-432-5041

Бір миллион адам геномы, бұл өзгеріс жасай ма? Тіршіліктің барлық түрлерінен алынған геномдық ақпараттың үлкен және өсіп келе жатқан көлемі есептеу биологтары үшін бұрын-соңды болмаған мүмкіндіктер береді. Біздің ғылыми ұрпағымыздың алдында тұрған міндет – жүйелі ақпараттың көшкінін биологиялық принциптердің, болжау әдістерінің немесе терапиялық және биоотынды ашу үшін молекулалық манипуляцияның стратегияларының мағыналы ашылуына айналдыру. Marks зертханасы - бұл биомедициналық зерттеулердегі маңызды қиындықтарға, әсіресе генетикалық вариацияны түсіндіруге және оның іргелі ғылым мен клиникалық медицинаға әсеріне қатысты қатаң есептеу тәсілдерін әзірлеуге арналған жаңа пәнаралық зертхана. Бұл мәселені шешу үшін біз коррелятивтік бақылаулардан себеп-салдарлықты анықтауға бағытталған биологиялық деректерге алгоритмдік тәсілдер әзірлейміз, бұл тәсіл бүгінге дейін күрделі мәселелерде таңқаларлық табысты болды. Атап айтқанда, біз белок тізбегіндегі қалдықтардың байқалатын эволюциялық корреляциясынан шынайы контактілерді ажырату үшін статистикалық физика мен графикалық модельдеуден бейімделген әдістерді әзірледік. Бір қызығы, тек реттілік бойынша анықталған бұл эволюциялық қосылыстар белоктар тізбегін 3D етіп бүктеу үшін жеткілікті ақпарат берді. Біз әзірлеген бағдарламалық қамтамасыз ету мен әдістер биологиялық қауымдастық үшін жалпыға қолжетімді серверде қол жетімді, оны сарапшы емес адамдар тез және оңай пайдалана алады. Бұл эволюциялық тәсілде біз жүздеген ақуыздардың және фармацевтикалық маңызды мембраналық ақуыздардың 3D құрылымын дәл болжадық. Олардың көпшілігі бұрын белгісіз құрылымға ие болды және белгілі реттіліктерге гомологиясы жоқ екі үлкен мембраналық ақуыздар қазір эксперименталды түрде расталды. Біз қазір жеткілікті реттіліктері бар және баламалы конформациялардың эволюциялық белгісін көрсете алатын барлық ақуыздық өзара әрекеттесулердің 3D құрылымын анықтау үшін осы тәсілді геномды кеңінен қолдандық.

Marks зертханасының мақсаты үш маңызды мәселені шешетін есептеу әдістерін құру болып табылады (i) денсаулық пен аурудағы ақуыздың конформациялық пластикасы, (ii) аурудың ықтималдығы, антибиотиктерге төзімділік және жеке дәрілік реакция бойынша мутацияларды геномдық бағалау және (iii) ) синтетикалық ақуызды жобалау.

Доктор Марк туралы: Мен геномды қалай оқуға және оның вариациясын түсіндіруге қызығушылық танытатын есептеуші биологпын. Жақында біз геномдық секвенирлеуден анықталған ақуыздың 3D құрылымын дәл тізбектерден, соның ішінде тәжірибелік қиын трансмембраналық ақуыздарды қоса алғанда, эволюциялық байланыстарды қолдандық. Осыны жалғастыра отырып, менің зертханам белоктардың балама конформациясы мен пластикасын және фармакологиялық араласудағы ақуыздың генетикалық вариациясының салдарын болжауға бағытталған. Қосымша тәсілде біз көптеген бұзылулар мен мыңдаған қатерлі ісік пациенттерінің тіндерінен алынған деректердің үлкен денелерін біріктіру арқылы дәрілердің пациенттерге және жасушалық желілерге әсерін зерттейміз.


Жылдам құрылымдар

AlphaFold болжамы Лупас зертханасы жылдар бойы сындыруға тырысқан бактериялық ақуыздың құрылымын анықтауға көмектесті. Лупастың командасы бұрын шикі рентгендік дифракция деректерін жинаған болатын, бірақ бұл Роршах тәрізді үлгілерді құрылымға айналдыру үшін ақуыздың пішіні туралы кейбір ақпарат қажет. Бұл ақпаратты алудың амалдары, сондай-ақ басқа болжау құралдары сәтсіз болды. Лупас: «427-топтағы модель бізге он жыл бойы бәрін сынап көргеннен кейін жарты сағатта құрылымымызды берді», - дейді.

DeepMind негізін қалаушы және бас атқарушы директоры Демис Хассабис компания AlphaFold қолданбасын басқа ғалымдар қолдана алатындай пайдалы етуді жоспарлап отырғанын айтады. (Ол бұрын AlphaFold бағдарламасының бірінші нұсқасы туралы басқа ғалымдардың әдісті қайталауы үшін жеткілікті мәліметтерді жариялаған болатын.) Белоктың әртүрлі аймақтарының сенімділігін бағалауды қамтитын болжамды құрылымды жасау үшін AlphaFold бірнеше күн қажет болуы мүмкін. «Біз биологтардың не қалайтынын енді ғана түсініп жатырмыз», - деп қосты Хассабис, ол дәрі-дәрмектің ашылуы мен ақуыз дизайнын әлеуетті қолданбалар ретінде қарастырады.

2020 жылдың басында компания эксперименталды түрде анықталмаған бірнеше SARS-CoV-2 ақуыздарының құрылымдары туралы болжамдарды шығарды. DeepMind-тің Orf3a деп аталатын ақуызға қатысты болжамдары кейінірек крио-ЭМ арқылы анықталғанға өте ұқсас болды, дейді Берклидегі Калифорния университетінің молекулалық нейробиологы Стивен Брохаун, оның командасы құрылымды маусым айында шығарған. «Олардың істей алғаны өте әсерлі», - деп қосты ол.


Құрылымды болжау үшін белоктар тізбегін пайдалану

Ақуыздар әдетте өмір сүруге мүмкіндік беретін молекулалар ретінде аталды, ақуыз сөзі грек тілінен шыққан протеоз «бастапқы», «жетекші» немесе «алдында тұрған» дегенді білдіреді. Тірі жүйелер әртүрлі белоктардың кең жиынтығынан тұрады. Адам геномында кодталған 50 000-ға жуық әртүрлі ақуыздар бар және бір жасушада бір ақуыздың 20 000 000 көшірмесі болуы мүмкін. 1

Әрбір ақуыз өзін-өзі ұйымдастыратын жүйенің қызықты мысалын ұсынады. Молекула аминқышқылдарының құрылыс блоктарының тізбегі ретінде жинақталған, олар бір-бірімен пептидтік байланыстармен байланысып, сызықтық полимерді құрайды. Синтезделгеннен кейін бұл полимер өздігінен жұмыс істеу үшін қажетті дұрыс және жоғары реттелген үш өлшемді құрылымға өздігінен жиналады. Бұл өздігінен жиналу қабілеті керемет - әрбір сызықтық полипептидтік тізбек жоғары дәрежеде ұйымдастырылмаған және біз оларды санай алмайтындай кең конформациялар массивін қабылдау мүмкіндігіне ие, бірақ бір секундтан аз уақыт ішінде әдеттегі ақуыз өздігінен дұрыс, жоғары деңгейді қабылдайды. функциясы үшін қажет реттелген үш өлшемді құрылым. Осы полипептидті құрайтын аминқышқылдарының сәйкестігі мен реті, яғни белок тізбегі, әдетте, бүктелген функционалды молекуланы анықтауға қажетті барлық ақпаратты қамтиды. 2

1-сурет: A) Белгілі бір ақуызға арналған әрбір реттік позицияда (нөмірленген, кестенің жоғарғы қатарында) көрсетілген аминқышқылдары (әріптер, кестенің екінші қатары) полипептидтік тізбекке синтезделеді. B) Полимер тізбегі өздігінен молекулалық қызмет үшін қажетті ақуызға тән күрделі үш өлшемді құрылымға өздігінен жиналады. C) Бүктелгеннен кейін белок мономер ретінде сипатталады және көбінесе әртүрлі мономерлер немесе бір мономердің бірнеше көшірмелері функционалды молекулаларды құрайтын ақуыздық кешендерге өздігінен жиналады.

Қазіргі уақытта біз биология ғылымдары үшін өте қызықты уақытта өмір сүріп жатырмыз, қарапайым себеппен технологиялық жетістіктер біздің үлкен көлемдегі деректерді дәл жинау қабілетімізді айтарлықтай арттырды. Атап айтқанда, соңғы жиырма жыл ішінде белоктардың реттілігін арзан және дәл анықтау мүмкіндігіміз айтарлықтай өсті, бұл әртүрлі түрлерден ақуыз тізбегінің үлкен, еркін қол жетімді топтамаларын жинауға әкелді. Дегенмен, ақуыздың үш өлшемді құрылымын эксперименталды түрде анықтау қымбат және қиын, сондықтан біз оның үш өлшемді құрылымын болжау үшін әрбір ақуыз үшін қол жетімді тізбек деректерін пайдалана аламыз ба деген сұраққа әкеледі. Ең бастысы, белгілі бір ақуыздың реттілігі әртүрлі түрлер арасында өзгереді. Гемоглобин (1-сурет), оттегін байланыстыратын және тасымалдайтын қандағы ақуыз жақсы мысал болып табылады. Гемоглобиннің әр түрдегі нұсқалары үш өлшемді құрылымы бойынша да, атқаратын қызметі бойынша да өте ұқсас. Дегенмен, әртүрлі түрлерде кездесетін гемоглобин аминқышқылдарының тізбегі арасында айырмашылықтар бар. Зерттеудің қызықты қазіргі бағыты осы эволюциялық реттілік вариациясын пайдалану және аминқышқылдарының тізбегін ақуыз құрылымы мен функциясына қатысты кодты бұзу болып табылады. 3,4

Жүйелілік деректеріне негізделген модель
Негізгі идея - әрбір қызығушылық танытатын ақуызды кодтайтын аминқышқылдарының тізбегі үшін ықтималдық үлгісін құру үшін қазір қол жетімді ақуыз тізбегі деректерінің көптігін пайдалану. Кезектілік үшін ықтималдық үлестірімі, P(A1, A2, . An), жиырма амин қышқылының әрқайсысының 1-позицияның әрқайсысында пайда болу ықтималдығын сипаттайды. n мүдделі ақуызды құрайтын n аминқышқылдарының тізбегінде. Егер біз қызығушылық тудыратын ақуыз үшін жеткілікті нақты деректер үлгілерін жинай алсақ және ықтималдықты бөлудің математикалық формасы туралы белгілі бір жорамалдар жасасақ, онда біз модельдің параметрлерін шығару үшін деректерді пайдалана аламыз. Көптеген белоктар үшін 10 000-нан астам реттілік қазір қол жетімді, бұл ықтималдық үлестірімінен үлгілер жинағын құрайтын деректер жиынтығы, бірақ бұл жиынның элементтері бір-бірінен тәуелсіз таңдалмаған.

Ықтималдық моделі қандай формада болуы керек? Белгілі бір ақуыз үшін байқалған деректерді генерациялайтын модельдер кеңістігі шектелмеген. Дегенмен, біз өткен ғасырда биологтар жинаған ақуыздар туралы білімді модельдердің белгілі бір кластарына назар аударуды шектеу үшін пайдалана аламыз. Әртүрлі популяциялардағы тұрақты вариация бойынша іріктеу процесі көптеген түрлерде белгілі бір ақуыздың тізбегін жасайды. Эволюциялық процесс арқылы белоктағы әртүрлі реттілік позицияларындағы мутациялар (аминқышқылдарының өзгеруі) кездейсоқ түзіледі. Бұл мутациялардың кейбіреулері ақуыздың жетілдірілген нұсқасына әкеледі, ағзаның жарамдылығын арттырады, сондықтан таңдалады. Ықтимал тізбектердің жоғары өлшемді кеңістігі бар, қызығушылық танытатын ақуызға сәйкес тізбектер осы кеңістіктің кейбір ішкі жиынын алады. Белгілі бір ақуызды кодтайтын дерекқорда жиналған тізбектер осы ішкі жиынның шекараларын зерттейтін миллиондаған эволюциялық эксперименттердің нәтижелерін жазады. Шекаралар белоктың функционалды болуы талабымен белгіленеді, идея реттіліктерге рұқсат етілген шекараларды немесе шектеулерді шығару, осылайша аминқышқылдарының тізбегі мен ақуыз қызметі арасындағы байланыс туралы білу.

Ең бастысы, әртүрлі учаскелердегі мутациялардың ақуызға тәуелсіз әсер етуі міндетті емес. Атап айтқанда, дәйектіліктегі бір позициядағы жалғыз мутация бұдан былай жұмыс істемейтін ақуызға әкелетіні жиі байқалады, мүмкін ол дұрыс қатпағандықтан, бұл мүгедектікті басқа жерде пайда болатын компенсаторлық мутация арқылы құтқаруға болады. ақуыз тізбегі. Бұл ықтималдық үлгісіне әртүрлі реттілік позициялары арасындағы өзара әрекеттесулерді қосу керек екенін көрсетеді. Көптеген ақуыздар үшін қол жетімді тізбектердің саны үлкен болғанымен, әртүрлі реттердің өзара әрекеттесуін қарастыратын модель үшін ықтимал параметрлер кеңістігі әлдеқайда үлкен, сондықтан біз әртүрлі реттілік позициялары арасындағы жұптық өзара әрекеттесулерді қарастыратын модельдерге назар аударамыз. Егер екі аминқышқылдары үш өлшемді ақуыз құрылымында жақын орналасса (мысалы, олар бір-біріне қарсы тұрса немесе сутегі байланысы арқылы әрекеттесе), олардың әртүрлі түрлердегі мутация үлгісінде корреляция болуы мүмкін деп болжаймыз. 2-суретте көрсетілген ойыншық үлгісі. Егер бұл модель дәл болса, ол реттілік деректерінен үш өлшемді ақуыз құрылымындағы аминқышқылдарының кеңістіктік жақындығын болжау үшін жұптық өзара әрекеттесулерді қолдануға болады деп болжайды.

2-сурет: A) Ойыншық үлгісі бір реттік позициядағы мутация бұдан былай қатпарланбайтын немесе дұрыс жұмыс істемейтін ақуызға әкелетін мысалды көрсетеді. Ақуыз функциясының бұл жоғалуы молекуланың қатпарлану және жұмыс істеу қабілетін қалпына келтіре отырып, дәйектіліктің басқа жерінде компенсаторлық мутация арқылы құтқарылады. B) Егер бұл модель дұрыс болса, бұл біздің реттілік дерекқорымызда тек i) мутациялардың ешқайсысы жоқ немесе ii) мутациялардың екеуі де, демек, осы екі реттілікке сәйкес келетін екі бағанның мутация үлгісі бар тізбектерді ғана қамтитынын білдіреді. позициялары өзара байланысты болады.

Қызығушылық танытқан ақуыздың үш өлшемді құрылымын эксперименталды түрде анықтау қымбат және көп уақытты қажет ететін процесс болып табылады және көптеген трансмембраналық ақуыздар үшін (ерімейтін, өйткені олар жасушаны байланыстыратын гидрофобты липидті қос қабатты) бұл әлі мүмкін емес. Ақуыздың үш өлшемді құрылымын оның аминқышқылдарының тізбегінен болжау мәселесі кем дегенде соңғы елу жыл бойы ғалымдарды қызықтырды. Бұл мәселенің шешілмейтін себептерінің бір бөлігі - әрбір ақуыз тізбегі теориялық түрде қабылдай алатын ықтимал конформациялардың көптігі. Әрбір ақуыз тізбегі әдетте жүздеген немесе кейбір жағдайларда мыңдаған аминқышқылдарынан тұрады.

Конформациялық іздеу кеңістігінің шамасының реттілігін шамамен есептеу үшін әрбір амин қышқылының полипептидтік тізбек контекстінде оның конформациясын сипаттайтын екі тәуелсіз байланыс бұрышы бар екенін ескеріңіз және оған кем дегенде сипаттайтын қосымша еркіндік дәрежесін қосыңыз. амин қышқылының бүйірлік тізбегінің бағыты. Консервативті түрде әрбір еркіндік дәрежесі 10 мәннің шектеулі жиынтығын ғана қабылдай алады деп есептесек, бұл бір амин қышқылына кемінде 10 3 = 1000 түрлі құрылымдық конформацияны қамтамасыз етеді, яғни мыналардан тұратын ақуыз үшін (10 3) 150 ықтимал конфигурациялар. бар болғаны 150 аминқышқылдары. Тіпті табиғи құрылымда икемділік болса да - мысалы, аминқышқылдарының бүйірлік тізбектері белгілі бір дәрежеде айналуға қабілетті болса - ақуыздың жергілікті қатпарлы құрылымы осы үлкен кеңістіктің аз ғана бөлігін алады, бұл оны кез келген түр үшін есептеуге қиын етеді. дөрекі күшпен іздеу тәсілі. Егер тізбек конформацияларды наносекунд немесе пикосекундтық жылдамдықпен таңдай алса, дұрыс табиғи конформацияны (Левинталь парадоксы) табу үшін әлі де ғаламның жасынан көп уақыт қажет болар еді. 5 Ақуыздардың биологиялық сәйкес уақыт шкалаларында қатпарлануы фактісі белок тізбегі жылдам және сенімді бүктеуді қамтамасыз ету үшін эволюциялық процесс арқылы оңтайландырылғанын көрсетеді.

Ақуыздың бірнеше секунд ішінде дұрыс құрылымға өздігінен жиналуына мүмкіндік беретін энергетикалық ландшафттың пішіні әртүрлі аминқышқылдары арасындағы физикалық өзара әрекеттесу арқылы анықталады. Протеиннің қатпарлану мәселесін есептеу үшін модельдеу үшін ақуыз атомдары арасындағы және қоршаған еріткіш атомдарымен физикалық өзара әрекеттесулердің жуықтауларын қолдануға әрекет жасалды. Кейбір кішкентай белоктардың құрылымдарын дәл болжауға мүмкіндік беретін прогреске қол жеткізілгенімен, мәселе тіпті ірі түйіршікті жуықтауларды қолданған кезде де есептеу қиын болып қала береді. Қазіргі уақытта біз белок динамикасының миллисекундтан астамын имитациялай алмаймыз, бұл үлкен белоктар үшін қатпарлану траекторияларын модельдеуге жол бермейді.

Ықтималдық моделі
Мәселе мынада: белгілі бір ақуызға әкелетін аминқышқылдары тізбегінің кеңістігіндегі шектеулерді немесе шектеулерді анықтау үшін қол жетімді реттілік деректерін қалай тиімді пайдалануға болады. Бұл типтік кері есеп, біз деректерді модельдік шектеулерді шығару үшін, яғни ықтималдық үлестірімін параметрлеу үшін пайдаланғымыз келеді. Бұл ықтималдық үлестірімі қандай формада болуы керек деген шешуші сұрақты тудырады. Ықтималдық моделі бақыланатын деректердің статистикасын қайта шығаруын талап етсек те, мұны жасайтын көптеген модельдер бар. Біз осылардың ішінен бір үлгіні таңдағымыз келеді, сондықтан біз максималды энтропия моделін таңдаймыз, яғни бақыланатын деректерді шығаратын ең аз шектелген модель. Атап айтқанда, біз мүдделі протеин үшін қолжетімді реттілік туралауында жеке тораптар мен тораптардың әрбір жұбына арналған эмпирикалық жиілік сандарына сәйкес келетін әрбір тораптар жұбына арналған бірыңғай торап маржиналдарын және шеттерін сұраймыз. Статистикалық физикадан белгілі алынған Поттс моделі ақуыз тізбегі кеңістігіндегі ғаламдық ықтималдық моделін анықтайды: Мұндағы eij(а,б) деп аталады муфталар, және hмен өрістер.

Мұнда болып табылады бөлу функциясы, бұл ықтималдықтардың дұрыс нормалануын қамтамасыз етеді.

Әр ақуыз үшін деректерден басқа модель құрастырылады және кез келген қызығушылық тізбегі модель құрастырылған ақуызды көрсету ықтималдығын береді. Қысқаша айтқанда, қызығушылық танытатын ақуыз үшін қол жетімді тізбектер жиынтығы осы модель үшін параметрлерді шығару үшін пайдаланылады.

Бір болжам бойынша, ең жоғары өзара әрекеттесу ұпайы бар дәйектілік позицияларының жұптары үш өлшемді ақуыз құрылымында жақын құрылымдық жақындықта болады. Қорытындылау процедурасының болжамдық күшін тексеру үшін біз тізбек позицияларының ең жоғары ұпай жұптарын мысал ақуызының эксперименталды түрде шешілген кристалдық құрылымымен салыстырамыз. 3-суретте модель болжамдары (қызыл жұлдыздар) мен кристалдық құрылым деректері (сұр нүктелер) арасындағы сәйкестік өте жақсы көрсетілген.

3-сурет: Сұр түсте үш өлшемді кристалдық құрылым деректерінің екі өлшемді картасы - бұл екілік матрица, мұнда '1' кристалдық құрылымдағы қашықтық 5 ангстромнан аз екі аминқышқылын білдіреді. Реттілік деректерінен алынған максималды энтропия моделінен ең жоғары балл алған аминқышқылдарының жұптары қызыл түспен сызылған. Көптеген қызыл нүктелердің сұр нүктелермен сәйкес келуі тізбек деректерінен үш өлшемді ақуыз құрылымы туралы ақпаратты болжай алатынымызды көрсетеді.

Бұл өте таңқаларлық нәтиже, ол реттілік деректерінен алынған ақпарат үш өлшемді ақуыз құрылымын болжау үшін жеткілікті ме деген сұрақты бірден тудырады. Бұл гипотезаны тексеру үшін біз қызығушылық танытатын ақуызға арналған ашылған полипептидтік тізбектен бастаймыз және құрылымдық модельде әрбір жоғары баллдық жұптағы екі амин қышқылдары бір-бірінен 7 ангстром ішінде екенін анықтау үшін қашықтық геометриясы деп аталатын алгоритмді қолданамыз. Протеин тізбегінен болжанған қайталама құрылымды көрсететін қашықтық шектеулері де қамтылған.

4-сурет: RAS ақуызы үшін болжамды үш өлшемді ақуыз құрылымын кристалдық құрылыммен (сұр) салыстыру. Біздің болжамды құрылымның C∝-атомдары мен эксперименталды түрде шешілген кристалдық құрылым арасындағы орташа квадраттық ауытқу 3,5 ангстромды құрайды, бұл төмен ажыратымдылықтағы кристалдық құрылыммен салыстырылады.

Біз протеиннің үш өлшемді құрылымын дәл болжау үшін осы үлкен дәйекті теңестірулерде жеткілікті ақпарат бар екенін анықтаймыз. 6 Бұл статистикалық әдіс глобулярлық және трансмембраналық белоктар ауқымы үшін белок тізбегі, құрылымдарын болжау арқылы белоктардың қатпарлану мәселесінде прогреске қол жеткізеді. Сонымен қатар, эксперименттік құрылымы әлі шешілмеген трансмембраналық ақуыздар жиынтығы үшін осы әдістерді қолдана отырып, үш өлшемді құрылымдар болжанған. Бұлардың көбі
белоктар адам ауруларында маңызды болып табылады және болжамды құрылымдардың болуы олардың функцияларының үлгілерін құруға және ықтимал валидациялауға мүмкіндік береді. Ақуыз құрылымына жарық түсіру үшін эволюциялық вариацияны пайдалану мүмкіндігі қызықты болғанымен, аминқышқылдарының реттілігі мен ақуыз функциясы арасындағы қарым-қатынастың негізгі мәселесі одан әрі жұмысты қажет етеді. Атап айтқанда, ақуыздың құрамындағы аминқышқылдары топтарының келісілген әрекеттері әртүрлі ақуыз фенотиптеріне қалай әкелетінін түсіну маңызды болады, сонымен қатар оларды ақуыз тізбегінің үлкен жинақтарынан қалай болжауға болады. 3,4

Люси Колуэлл, Жаратылыстану ғылымдары мектебінің келушісі (2013) және мүшесі (2012–13), Кембридж университетінің ассистенті профессоры. Ол биологиялық реттілік пен фенотип арасындағы байланысты жақсырақ түсіну үшін математикалық әдістерді қолдануға және дамытуға мүдделі, атап айтқанда белоктар мен ақуыз кешендері деңгейінде.

1. Бек, Мартин және т.б. «Адам жасушасының сандық протеомы», Молекулалық жүйелер биологиясы 7.1 (2011).
2. Анфинсен, Кристиан Б., т.б. «Қысқартылған полипептидтік тізбектің тотығуы кезіндегі табиғи рибонуклеазаның түзілу кинетикасы», Ұлттық ғылым академиясының материалдары, 47.9 1309 (1961).
3. Скеркер Дж.М., Перчук Б.С., Сиряпорн А., Любин Е.А., Ашенберг О., т.б. «Екі компонентті сигнал беру жүйелерінің ерекшелігін қайта орнату», Ұяшық 133: 1043–54 (2008).
4. Халаби Н., Ривуар О., Лейблер С., Ранганатан Р. «Белок секторлары: үш өлшемді құрылымның эволюциялық бірліктері,» Ұяшық 138: 774–86 (2009).
5. Левинтал, Кир. «Қалай сыпайы түрде бүктеуге болады», Биологиялық жүйелердегі Моссбауэр спектроскопиясы 22–24 (1969).
6. Маркс Дебора С., Колвелл Люси Дж., т.б. «Эволюциялық реттілік вариациясынан есептелген ақуыздың 3D құрылымы», PLOS One 6.12: e28766 (2011).


Денатурация және ақуыздың қатпарлануы

Әрбір ақуыздың химиялық әрекеттесу арқылы біріктірілген өзінің бірегей реті мен пішіні болады. Егер ақуыз температураның, рН-ның өзгеруіне немесе химиялық заттардың әсеріне ұшыраса, ақуыз құрылымы өзгеруі мүмкін. Бұл ақуыздың бастапқы реттілігін жоғалтпай пішінін жоғалтуына әкелуі мүмкін. Біз бұл құбылысты деп атаймыз денатурация.

Қайтымды және қайтымсыз денатурация

Денатурация көбінесе қайтымды болады. Өйткені денатурациялаушы агент жойылса, ақуыздың жұмысын қалпына келтіруге мүмкіндік беретін полипептидтің бастапқы құрылымы процесте сақталады. Кейде денатурация қайтымсыз болады, бұл функцияның жоғалуына әкеледі. Қайтымсыз ақуыз денатурациясының бір мысалы - жұмыртқаны қуыру. The albumin protein in the liquid egg white is denatured when placed in a hot pan (see image below).

(Top) albumin in raw and cooked egg white (Bottom) an analogy to help visualize the process of protein denaturation. Image Attribution: Wikimedia Commons (CC BY-SA 3.0)

Not all proteins are denatured at high temperatures. For instance, bacteria that survive in hot springs have proteins that function at temperatures close to boiling. The stomach is also very acidic, has a low pH, and denatures proteins as part of the digestion process. However, the digestive enzymes of the stomach retain their activity under these conditions.

Is denatured protein still good?

The peptide bonds that are present in protein are broken. However, despite the change in the structure of the protein, denatured protein still contains all of the amino acids that are found in other forms of the protein. As a result, denatured proteins are still nutritionally beneficial.

Protein Folding

Protein before and after folding. Image Attribution: Wikimedia Commons (public domain)

Protein folding is critical to its function. It was originally thought that the proteins themselves were responsible for the folding process. Only recently was it found that often they receive assistance in the folding process from protein helpers that associate with the target protein during the folding process. We refer to this protein helpers as known as шаперондар (or chaperonins). They act by preventing aggregation of polypeptides that make up the complete protein structure, and they disassociate from the protein once the target protein is folded.


Каперондар

  • Полипептид синтезделіп жатқанда, ол рибосомадан (бірінші N-терминал) шығады және қатпарлану процесі басталады.
  • Дегенмен, пайда болған полипептид сулы цитозолмен және басқа да көптеген ақуыздармен қоршалған.
  • Гидрофобты аминқышқылдары пайда болған кезде олар байланысу үшін басқа гидрофобты аминқышқылдарын табуы керек. Ең дұрысы, олар өздеріне тиесілі болуы керек, бірақ олардың орнына жақын маңдағы ақуыздармен байланысу қаупі бар және агрегацияға және тиісті үшінші құрылымды қалыптастырудың сәтсіздігіне әкеледі.

Бұл проблеманы болдырмау үшін барлық ағзалардың жасушаларында жаңадан түзілген полипептидтерді олардың дұрыс құрылымына бүктелген кезде тұрақтандыратын молекулалық шаперондар бар. Шаперондар бұл жұмысты орындау үшін АТФ энергиясын пайдаланады.

Шаперониндер

Кейбір ақуыздар соншалықты күрделі, сондықтан шаперониндер және mdash деп аталатын молекулалық шаперондар мен mdash жиынтығы қажет.

Шаперониндер - жаңадан синтезделген белок қатпарланып жатқанда оған енетін қуыс цилиндрлер.

Шаперониндер сонымен қатар АТФ-ны бүктеу процесін жүргізу үшін қуат көзі ретінде пайдаланады.

Жоғарыда айтылғандай, жоғары температура ақуыздарды денатурациялауы мүмкін, ал жасуша жоғары температураға ұшыраған кезде молекулалық шаперондардың бірнеше түрі әрекет етеді. Осы себепті бұл шаперондар деп те аталады жылу соққы белоктары (HSPs).

Молекулярлық шаперондар жаңадан синтезделген белоктардың бүктелуіне көмектесіп қана қоймайды, сонымен қатар олардың кейбіреулері біріктірілген белоктарды ашып, содан кейін ақуызды дұрыс қайталай алады. Ақуыз агрегациясы Альцгеймер ауруы, Хантингтон ауруы және прион аурулары (мысалы, «жынды сиыр» ауруы) сияқты бұзылулардың себебі болып табылады. Бір күні шаперондарды бөлудің тиімділігін арттыру арқылы осы ауруларды емдеудің жолдары табылуы мүмкін.

Шаперондардың маңыздылығына қарамастан, ереже әлі де сақталады: ақуыздың соңғы пішіні тек бір нәрсемен анықталады: аминқышқылдарының нақты тізбегі ақуызда.

Әр ақуыздағы аминқышқылдарының реттілігі сол белокты кодтайтын гендегі нуклеотидтердің реттілігіне байланысты. Демек, ағзадағы мыңдаған белоктардың әрқайсысының қызметі бір немесе бірнеше гендер арқылы анықталады.


AI has almost solved one of biology’s greatest challenges — how protein unfolds

A simple chain of amino acids folds into a complex three-dimensional structure | Marc Zimmer

S olving what biologists call “the protein-folding problem” is a big deal. Proteins are the workhorses of cells and are present in all living organisms. They are made up of long chains of amino acids and are vital for the structure of cells and communication between them as well as regulating all of the chemistry in the body.

This week, the Google-owned artificial intelligence company DeepMind demonstrated a deep-learning program called AlphaFold2, which experts are calling a breakthrough toward solving the grand challenge of protein folding.

Proteins are long chains of amino acids linked together like beads on a string. But for a protein to do its job in the cell, it must “fold” – a process of twisting and bending that transforms the molecule into a complex three-dimensional structure that can interact with its target in the cell. If the folding is disrupted, then the protein won’t form the correct shape – and it won’t be able to perform its job inside the body. This can lead to disease – as is the case in a common disease like Alzheimer’s, and rare ones like cystic fibrosis.

Deep learning is a computational technique that uses the often hidden information contained in vast datasets to solve questions of interest. It’s been used widely in fields such as games, speech and voice recognition, autonomous cars, science and medicine.

I believe that tools like AlphaFold2 will help scientists to design new types of proteins, ones that may, for example, help break down plastics and fight future viral pandemics and disease.

I am a computational chemist and author of the book The State of Science. My students and I study the structure and properties of fluorescent proteins using protein-folding computer programs based on classical physics.

After decades of study by thousands of research groups, these protein-folding prediction programs are very good at calculating structural changes that occur when we make small alterations to known molecules.

But they haven’t adequately managed to predict how proteins fold from scratch. Before deep learning came along, the protein-folding problem seemed impossibly hard, and it seemed poised to frustrate computational chemists for many decades to come.

A chain of amino acids goes through several folding steps, which occurs through hydrogen bonds between amino acids in different regions of the protein, before arriving at the final structure. The example shown here is hemoglobin, a protein in red blood cells that transports oxygen to body tissues.
Anatomy & Physiology, Connexions website, CC BY

Протеиннің қатпарлануы

The sequence of the amino acids – which is encoded in DNA – defines the protein’s 3D shape. The shape determines its function. If the structure of the protein changes, it is unable to perform its function. Correctly predicting protein folds based on the amino acid sequence could revolutionize drug design, and explain the causes of new and old diseases.

All proteins with the same sequence of amino acid building blocks fold into the same three-dimensional form, which optimizes the interactions between the amino acids. They do this within milliseconds, although they have an astronomical number of possible configurations available to them – about 10 to the power of 300. This massive number is what makes it hard to predict how a protein folds even when scientists know the full sequence of amino acids that go into making it. Previously predicting the structure of protein from the amino acid sequence was impossible. Protein structures were experimentally determined, a time-consuming and expensive endeavor.

Once researchers can better predict how proteins fold, they’ll be able to better understand how cells function and how misfolded proteins cause disease. Better protein prediction tools will also help us design drugs that can target a particular topological region of a protein where chemical reactions take place.

AlphaFold is born from deep-learning chess, Go and poker games

The success of DeepMind’s protein-folding prediction program, called AlphaFold, is not unexpected. Other deep-learning programs written by DeepMind have demolished the world’s best chess, Go and poker players.

In 2016 Stockfish-8, an open-source chess engine, was the world’s computer chess champion. It evaluated 70 million chess positions per second and had centuries of accumulated human chess strategies and decades of computer experience to draw upon. It played efficiently and brutally, mercilessly beating all its human challengers without an ounce of finesse. Enter deep learning.

On Dec. 7, 2017, Google’s deep-learning chess program AlphaZero thrashed Stockfish-8. The chess engines played 100 games, with AlphaZero winning 28 and tying 72. It didn’t lose a single game. AlphaZero did only 80,000 calculations per second, as opposed to Stockfish-8’s 70 million calculations, and it took just four hours to learn chess from scratch by playing against itself a few million times and optimizing its neural networks as it learned from its experience.

AlphaZero didn’t learn anything from humans or chess games played by humans. It taught itself and, in the process, derived strategies never seen before. In a commentary in Science magazine, former world chess champion Garry Kasparov wrote that by learning from playing itself, AlphaZero developed strategies that “reflect the truth” of chess rather than reflecting “the priorities and prejudices” of the programmers. “It’s the embodiment of the cliché ‘work smarter, not harder.’”

How do proteins fold?

CASP – the Olympics for molecular modelers

Every two years, the world’s top computational chemists test the abilities of their programs to predict the folding of proteins and compete in the Critical Assessment of Structure Prediction (CASP) competition.

In the competition, teams are given the linear sequence of amino acids for about 100 proteins for which the 3D shape is known but hasn’t yet been published they then have to compute how these sequences would fold. In 2018 AlphaFold, the deep-learning rookie at the competition, beat all the traditional programs – but barely.

Two years later, on Monday, it was announced that Alphafold2 had won the 2020 competition by a healthy margin. It whipped its competitors, and its predictions were comparable to the existing experimental results determined through gold standard techniques like X-ray diffraction crystallography and cryo-electron microscopy. Soon I expect AlphaFold2 and its progeny will be the methods of choice to determine protein structures before resorting to experimental techniques that require painstaking, laborious work on expensive instrumentation.

One of the reasons for AlphaFold2’s success is that it could use the Protein Database, which has over 170,000 experimentally determined 3D structures, to train itself to calculate the correctly folded structures of proteins.

The potential impact of AlphaFold can be appreciated if one compares the number of all published protein structures – approximately 170,000 – with the 180 million DNA and protein sequences deposited in the Universal Protein Database. AlphaFold will help us sort through treasure troves of DNA sequences hunting for new proteins with unique structures and functions.

Has AlphaFold made me, a molecular modeler, redundant?

As with the chess and Go programs – AlphaZero and AlphaGo – we don’t exactly know what the AlphaFold2 algorithm is doing and why it uses certain correlations, but we do know that it works.

Besides helping us predict the structures of important proteins, understanding AlphaFold’s “thinking” will also help us gain new insights into the mechanism of protein folding.

One of the most common fears expressed about AI is that it will lead to large-scale unemployment. AlphaFold still has a significant way to go before it can consistently and successfully predict protein folding.

However, once it has matured and the program can simulate protein folding, computational chemists will be integrally involved in improving the programs, trying to understand the underlying correlations used, and applying the program to solve important problems such as the protein misfolding associated with many diseases such as Alzheimer’s, Parkinson’s, cystic fibrosis and Huntington’s disease.

AlphaFold and its offspring will certainly change the way computational chemists work, but it won’t make them redundant. Other areas won’t be as fortunate. In the past robots were able to replace humans doing manual labor with AI, our cognitive skills are also being challenged.

Бұл мақала Creative Commons лицензиясы бойынша The Conversation журналынан қайта жарияланған. Бастапқы мақаланы оқыңыз.

YouTube және Telegram арналарымызға жазылыңыз

Неліктен БАҚ дағдарысқа ұшырады және оны қалай түзетуге болады

Үндістанға еркін, әділ, дефиссіз және күмән келтіретін журналистика қажет, өйткені ол көптеген дағдарыстарға тап болады.

Бірақ ақпарат құралдарының өзі дағдарыста. Жұмысшыларды аяусыз қысқарту және жалақыны қысқарту болды. Журналистиканың ең жақсысы – тарылып, дөрекі прайм-тайм көріністеріне берілу.

ThePrint-те ең жақсы жас тілшілер, шолушылар және редакторлар жұмыс істейді. Осындай сапада журналистиканы ұстап тұру үшін сіз сияқты ақылды және ойлайтын адамдар оны төлеуі керек. Сіз Үндістанда немесе шетелде тұрсаңыз да, мұны осында жасай аласыз.


Has AlphaFold made me, a molecular modeler, redundant?

As with the chess and Go programs – AlphaZero and AlphaGo – we don’t exactly know what the AlphaFold2 algorithm is doing and why it uses certain correlations, but we do know that it works.

Besides helping us predict the structures of important proteins, understanding AlphaFold’s “thinking” will also help us gain new insights into the mechanism of protein folding.

One of the most common fears expressed about AI is that it will lead to large-scale unemployment. AlphaFold still has a significant way to go before it can consistently and successfully predict protein folding.

However, once it has matured and the program can simulate protein folding, computational chemists will be integrally involved in improving the programs, trying to understand the underlying correlations used, and applying the program to solve important problems such as the protein misfolding associated with many diseases such as Alzheimer’s, Parkinson’s, cystic fibrosis and Huntington’s disease.

AlphaFold and its offspring will certainly change the way computational chemists work, but it won’t make them redundant. Other areas won’t be as fortunate. In the past robots were able to replace humans doing manual labor with AI, our cognitive skills are also being challenged.


Бейнені қараңыз: Ақтөрені орнына қойған үміткер! (Мамыр 2022).